PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen06g029270.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family WOX
Protein Properties Length: 236aa    MW: 25749.5 Da    PI: 5.7302
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen06g029270.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox49.85.7e-161979257
                      T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
          Homeobox  2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                      r+R+++++eq+ +Le+ F++   +p ++e  ++ k l     + +++V++WFqNrR + ++
  Sopen06g029270.1 19 RSRWNPKPEQIVILESIFNSgMVNPRKDETVRIRKMLeqfgAVGDANVFYWFQNRRSRSRR 79
                      89*****************99*************************************997 PP

2Wus_type_Homeobox107.86.4e-351881265
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                       +r+RW+P+peQi iLe++++sG+++P k+e+ ri+++Le++G+++d+NVfyWFQNr++R+r++q
   Sopen06g029270.1 18 VRSRWNPKPEQIVILESIFNSGMVNPRKDETVRIRKMLEQFGAVGDANVFYWFQNRRSRSRRRQ 81
                       689***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.13E-141386IPR009057Homeodomain-like
PROSITE profilePS5007111.3051580IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.2E-81684IPR009057Homeodomain-like
SMARTSM003892.8E-51784IPR001356Homeobox domain
PfamPF000461.1E-131979IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009734Biological Processauxin-activated signaling pathway
GO:0048830Biological Processadventitious root development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 236 aa     Download sequence    Send to blast
MDDDSSSSSQ SCERNETVRS RWNPKPEQIV ILESIFNSGM VNPRKDETVR IRKMLEQFGA  60
VGDANVFYWF QNRRSRSRRR QRQIQASLSA VSNSNEEQSA RSSDGGAIQF QTNFVPSSVS  120
SSSSSSLGGG VGNANDGLFL FSGPMGIDQN SSITSILCSA TDNSNLNCSS SGFITVFING  180
VAAQVPRGPL DMKAMFGPED LVLYHSSGVP LPVNEYGFVV QSLQHGESYF LLRHEA
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00330DAPTransfer from AT3G03660Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754450.0HG975445.1 Solanum pennellii chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015078118.11e-173PREDICTED: WUSCHEL-related homeobox 11 isoform X2
SwissprotQ6X7J31e-64WOX11_ARATH; WUSCHEL-related homeobox 11
TrEMBLK4C9091e-136K4C909_SOLLC; Uncharacterized protein
STRINGSolyc06g072890.1.11e-135(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA61662231
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03660.15e-63WUSCHEL related homeobox 11